PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT05405
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MYB_related
Protein Properties Length: 255aa    MW: 27100.8 Da    PI: 9.8557
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT05405genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.31.5e-12110154347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ +  ++G+g+W++I+r +   Rt+ q+ s+ qky
         EMT05405 110 PWTEEEHRLFLLGLDKFGKGDWRSISRNFVISRTPTQVASHAQKY 154
                      7*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.915103159IPR017930Myb domain
SuperFamilySSF466891.12E-16105160IPR009057Homeodomain-like
SMARTSM007172.3E-10107157IPR001005SANT/Myb domain
TIGRFAMsTIGR015573.2E-17107157IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.604.6E-11108153IPR009057Homeodomain-like
PfamPF002495.7E-11110154IPR001005SANT/Myb domain
CDDcd001675.95E-10110155No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0016556Biological ProcessmRNA modification
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MVSGFPATRA LAALALVVLS GQECGFAALA ASVPARSTEE VRRHYEALVE DVGAIDAGRV  60
PLPRYAGEDS SAAATAAAPS KDRREDRKSF DSDSGKGCSK AEQERRKGIP WTEEEHRLFL  120
LGLDKFGKGD WRSISRNFVI SRTPTQVASH AQKYFIRLHS MHRDRRRSSI HDITSINNAA  180
QAVPPITGQA PAALGGPPGG MMKHPGMVGM YGGAPMGHPV AGHMVPAAVG TPVMFPPGPG  240
HPPYAMPVGY PAPHQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519480.0JF951948.1 Triticum aestivum clone TaMYB65 MYB-related protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003565794.11e-111PREDICTED: transcription factor DIVARICATA
RefseqXP_004968851.11e-110PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H74e-48DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLM8AUQ50.0M8AUQ5_AEGTA; Myb-like protein J
STRINGBRADI2G13860.11e-110(Brachypodium distachyon)
STRINGSi002433m1e-110(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP94663041
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.17e-51MYB family protein